PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792226.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 185aa    MW: 21550.4 Da    PI: 10.0385
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792226.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.91.9e-211663249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +i+n++nrqvtfskRrn ++KKA+EL v+++aev +i+fs+ +k y +
  XP_009792226.1 16 KIDNETNRQVTFSKRRNSVFKKANELAVMTGAEVGIIVFSPANKPYSF 63
                    79*****************************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.404767IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-30766IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-26877IPR002100Transcription factor, MADS-box
CDDcd002651.91E-31875No hitNo description
PRINTSPR004049.4E-19929IPR002100Transcription factor, MADS-box
PfamPF003199.2E-241663IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-192944IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-194465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSTRLIKGRK KVRLAKIDNE TNRQVTFSKR RNSVFKKANE LAVMTGAEVG IIVFSPANKP  60
YSFGHPNVNE TIDKYVGEER RPSPSSPGID DKYVQMYRKA NSRALNTQLD YLQDQLDFAL  120
NLKSNLKEMN KNLDSQQEWF RDPIEKMNYT EASMLKERLE NLLLKVKNYG TERGYGYENG  180
RWKDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A2e-14890182MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B2e-14890182MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792226.11e-135PREDICTED: agamous-like MADS-box protein AGL62
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3829435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-33AGAMOUS-like 61